PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_3753_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MIKC_MADS
Protein Properties Length: 223aa    MW: 26166.9 Da    PI: 9.0135
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_3753_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.11.2e-28959151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   krien+snrqvt+skRrngi+KKA+E+ vLCda+v++iif+s+gk++ey+s
  Neem_3753_f_1  9 KRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAKVSLIIFASSGKMHEYCS 59
                   79***********************************************96 PP

2K-box77.72.9e-2671170195
          K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKne.....llleqieelqkkekelqeen 91 
                    y+++sgk+l++ k+e+l++e++++kke++++q ++Rhl+GedL+sL++keL+ +e++Le++l + R+k+       l+ e++e+++k  k+l+een
  Neem_3753_f_1  71 YHRQSGKRLWDPKHENLSNEIERIKKENDSMQIKLRHLKGEDLTSLNHKELMAIEDALESGLISLRDKQAStynmiLFSEEMERMRKNGKMLEEEN 166
                    78899***************************************************************976233225679**************** PP

          K-box  92 kaLr 95 
                    ++L+
  Neem_3753_f_1 167 TYLK 170
                    *997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.464161IPR002100Transcription factor, MADS-box
SMARTSM004324.5E-40160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-35296IPR002100Transcription factor, MADS-box
CDDcd002654.08E-39280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-28323IPR002100Transcription factor, MADS-box
PfamPF003191.9E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-283859IPR002100Transcription factor, MADS-box
PfamPF014861.1E-1983171IPR002487Transcription factor, K-box
PROSITE profilePS5129714.12684179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MGRGKIEIKR IENSSNRQVT YSKRRNGIIK KAKEITVLCD AKVSLIIFAS SGKMHEYCSP  60
STSLVDILEQ YHRQSGKRLW DPKHENLSNE IERIKKENDS MQIKLRHLKG EDLTSLNHKE  120
LMAIEDALES GLISLRDKQA STYNMILFSE EMERMRKNGK MLEEENTYLK FVLRQQEIAK  180
QQELAMENSV RAEIDHHHHH DYNSHLPFAF RVQPIQPNLQ ERI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D2e-16271168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-16271168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-16271168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-16271168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J3e-16289180Myocyte-specific enhancer factor 2A
3p57_I3e-16289180Myocyte-specific enhancer factor 2A
3p57_D3e-16289180Myocyte-specific enhancer factor 2A
3p57_C3e-16289180Myocyte-specific enhancer factor 2A
3p57_B3e-16289180Myocyte-specific enhancer factor 2A
3p57_A3e-16289180Myocyte-specific enhancer factor 2A
3kov_J3e-16289180Myocyte-specific enhancer factor 2A
3kov_I3e-16289180Myocyte-specific enhancer factor 2A
3kov_B3e-16289180Myocyte-specific enhancer factor 2A
3kov_A3e-16289180Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ4098698e-58FJ409869.1 Gossypium hirsutum MADS-12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015384126.11e-125PREDICTED: floral homeotic protein FBP1-like
SwissprotQ033781e-106GLOB_ANTMA; Floral homeotic protein GLOBOSA
TrEMBLV4TCY61e-124V4TCY6_9R
STRINGGLYMA13G09660.11e-105(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.16e-85MIKC_MADS family protein